Lineage for d1tbpa2 (1tbp A:156-240)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35722Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 35723Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 35775Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 35783Domain d1tbpa2: 1tbp A:156-240 [41283]

Details for d1tbpa2

PDB Entry: 1tbp (more details), 2.6 Å

PDB Description: crystal structure of yeast tata-binding protein and model for interaction with dna

SCOP Domain Sequences for d1tbpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbpa2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOP Domain Coordinates for d1tbpa2:

Click to download the PDB-style file with coordinates for d1tbpa2.
(The format of our PDB-style files is described here.)

Timeline for d1tbpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbpa1