Lineage for d1tbpa1 (1tbp A:61-155)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872516Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 872517Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 872518Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 872533Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 872544Domain d1tbpa1: 1tbp A:61-155 [41282]

Details for d1tbpa1

PDB Entry: 1tbp (more details), 2.6 Å

PDB Description: crystal structure of yeast tata-binding protein and model for interaction with dna
PDB Compounds: (A:) tata-binding protein

SCOP Domain Sequences for d1tbpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbpa1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOP Domain Coordinates for d1tbpa1:

Click to download the PDB-style file with coordinates for d1tbpa1.
(The format of our PDB-style files is described here.)

Timeline for d1tbpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tbpa2