| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
| Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
| Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
| Domain d1tbpa1: 1tbp A:61-155 [41282] |
PDB Entry: 1tbp (more details), 2.6 Å
SCOP Domain Sequences for d1tbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tbpa1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf
Timeline for d1tbpa1: