Lineage for d2g3ne3 (2g3n E:528-604)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810909Protein Maltase, domain 3 [310753] (2 species)
  7. 2810917Species Sulfolobus solfataricus [TaxId:2287] [419648] (2 PDB entries)
  8. 2810927Domain d2g3ne3: 2g3n E:528-604 [412810]
    Other proteins in same PDB: d2g3na1, d2g3na2, d2g3na4, d2g3na5, d2g3nb1, d2g3nb2, d2g3nb4, d2g3nb5, d2g3nc1, d2g3nc2, d2g3nc4, d2g3nc5, d2g3nd1, d2g3nd2, d2g3nd4, d2g3nd5, d2g3ne1, d2g3ne2, d2g3ne4, d2g3ne5, d2g3nf1, d2g3nf2, d2g3nf4, d2g3nf5
    automated match to d2g3ma3
    complexed with bog

Details for d2g3ne3

PDB Entry: 2g3n (more details), 2.55 Å

PDB Description: crystal structure of the sulfolobus solfataricus alpha-glucosidase mala in complex with beta-octyl-glucopyranoside
PDB Compounds: (E:) alpha-glucosidase

SCOPe Domain Sequences for d2g3ne3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3ne3 b.71.1.4 (E:528-604) Maltase, domain 3 {Sulfolobus solfataricus [TaxId: 2287]}
pvirplfyefqddddmyriedeymvgkyllyapivskeesrlvtlprgkwynywngeiin
gksvvksthelpiylre

SCOPe Domain Coordinates for d2g3ne3:

Click to download the PDB-style file with coordinates for d2g3ne3.
(The format of our PDB-style files is described here.)

Timeline for d2g3ne3:

  • d2g3ne3 is new in SCOPe 2.08-stable