Lineage for d1ytfa2 (1ytf A:156-240)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83827Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 83828Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 83829Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 83890Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 83896Domain d1ytfa2: 1ytf A:156-240 [41281]
    Other proteins in same PDB: d1ytfb1, d1ytfc1, d1ytfd1, d1ytfd2

Details for d1ytfa2

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfa2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOP Domain Coordinates for d1ytfa2:

Click to download the PDB-style file with coordinates for d1ytfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ytfa2: