Lineage for d1ytfa1 (1ytf A:61-155)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926122Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1926123Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1926124Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1926125Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 1926134Domain d1ytfa1: 1ytf A:61-155 [41280]
    Other proteins in same PDB: d1ytfb_, d1ytfc_, d1ytfd1, d1ytfd2
    protein/DNA complex

Details for d1ytfa1

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex
PDB Compounds: (A:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1ytfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfa1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOPe Domain Coordinates for d1ytfa1:

Click to download the PDB-style file with coordinates for d1ytfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ytfa1: