Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
Domain d1ytfa1: 1ytf A:61-155 [41280] Other proteins in same PDB: d1ytfb_, d1ytfc_, d1ytfd1, d1ytfd2 |
PDB Entry: 1ytf (more details), 2.5 Å
SCOP Domain Sequences for d1ytfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytfa1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk mvvtgakseddsklasrkyariiqkigfaakftdf
Timeline for d1ytfa1:
View in 3D Domains from other chains: (mouse over for more information) d1ytfb_, d1ytfc_, d1ytfd1, d1ytfd2 |