Lineage for d1ytbb2 (1ytb B:156-240)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581739Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2581740Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2581741Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2581742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 2581746Domain d1ytbb2: 1ytb B:156-240 [41279]
    complexed with DNA containing TATA-box
    protein/DNA complex

Details for d1ytbb2

PDB Entry: 1ytb (more details), 1.8 Å

PDB Description: crystal structure of a yeast tbp/tata-box complex
PDB Compounds: (B:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1ytbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytbb2 d.129.1.1 (B:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOPe Domain Coordinates for d1ytbb2:

Click to download the PDB-style file with coordinates for d1ytbb2.
(The format of our PDB-style files is described here.)

Timeline for d1ytbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytbb1