SCOP 1.59: Domain d1ytbb1: 1ytb B:61-155

Lineage for d1ytbb1 (1ytb B:61-155)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)

8. Domain d1ytbb1: 1ytb B:61-155 [41278]

Details for d1ytbb1

PDB Entry: 1ytb, 1.8 Å

PDB Description: crystal structure of a yeast tbp/tata-box complex

SCOP Domain Sequences for d1ytbb1:

Sequence; same for both SEQRES and ATOM records:

>d1ytbb1 d.129.1.1 (B:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

Timeline for d1ytbb1:

• d1ytbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ytbb1 appears in SCOP 1.57
  
• d1ytbb1 appears in SCOP 1.61
  
• d1ytbb1 appears in the current release, SCOPe 2.08