Lineage for d1ytba1 (1ytb A:61-155)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83827Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 83828Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 83829Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 83890Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (4 PDB entries)
  8. 83891Domain d1ytba1: 1ytb A:61-155 [41276]

Details for d1ytba1

PDB Entry: 1ytb (more details), 1.8 Å

PDB Description: crystal structure of a yeast tbp/tata-box complex

SCOP Domain Sequences for d1ytba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytba1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOP Domain Coordinates for d1ytba1:

Click to download the PDB-style file with coordinates for d1ytba1.
(The format of our PDB-style files is described here.)

Timeline for d1ytba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytba2