Lineage for d1volb2 (1vol B:116-198)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538748Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2538749Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2538808Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)
  8. 2538858Domain d1volb2: 1vol B:116-198 [41275]
    Other proteins in same PDB: d1vola1, d1vola2
    protein/DNA complex

Details for d1volb2

PDB Entry: 1vol (more details), 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
PDB Compounds: (B:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1volb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1volb2 d.129.1.1 (B:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

SCOPe Domain Coordinates for d1volb2:

Click to download the PDB-style file with coordinates for d1volb2.
(The format of our PDB-style files is described here.)

Timeline for d1volb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1volb1