Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries) |
Domain d1volb1: 1vol B:12-115 [41274] Other proteins in same PDB: d1vola1, d1vola2 protein/DNA complex |
PDB Entry: 1vol (more details), 2.7 Å
SCOPe Domain Sequences for d1volb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1volb1 d.129.1.1 (B:12-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki
Timeline for d1volb1: