Lineage for d1zu0a_ (1zu0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916398Species Vibrio cholerae [TaxId:666] [328970] (4 PDB entries)
  8. 2916402Domain d1zu0a_: 1zu0 A: [412735]
    automated match to d6lzta_
    complexed with mn

Details for d1zu0a_

PDB Entry: 1zu0 (more details), 2.2 Å

PDB Description: crystal structure of the liganded chitin oligasaccharide binding protein
PDB Compounds: (A:) Chitin Oligosaccharide Binding Protein

SCOPe Domain Sequences for d1zu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zu0a_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
rseltivpdfyptmvrnfnpylatnlrtttdfiyeplvvfnemkgntpvfrlaesykmad
dlmsvtfdirkgvkwsdgeaftaddvvysfgllkakpeldqrginkwvtsvekvdeykvr
frlseansnvpyeislipivaehvwkdvkdpttftnenpvgtgpftvidtftpqlyiqcr
npnywdaanlevdclrvpqianndqllgkivnseldwtssfvpdidrtyaaanpnhhywy
paagtqafmvnfknpdpakkealdnvdfrrafsmaldrqtiidiafygsgtvndfasglg
yafeawsdeathkkykgfntydvegskkllakagfkdvngdgfvetpsgksfelliqspn
gwtdfnntvqlaveqlqevgikakartpefavynqamlegtydvaytnyfhgadpftywn
sgynsalqsgdgmprfamhyftdkkldglldsfyktadkneqlaiahgiqkiiaenqvti
pvmsgawmyqynttrftgwwseenpkgrpsvwagiperllhvldlkpvk

SCOPe Domain Coordinates for d1zu0a_:

Click to download the PDB-style file with coordinates for d1zu0a_.
(The format of our PDB-style files is described here.)

Timeline for d1zu0a_:

  • d1zu0a_ is new in SCOPe 2.08-stable