SCOPe 2.05: Domain d1qnbb2: 1qnb B:116-198

Lineage for d1qnbb2 (1qnb B:116-198)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1qnbb2: 1qnb B:116-198 [41269]

Details for d1qnbb2

PDB Entry: 1qnb, 2.23 Å

PDB Description: crystal structure of the t(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.

PDB Compounds: (B:) transcription initiation factor tfiid-1

SCOPe Domain Sequences for d1qnbb2:

Sequence; same for both SEQRES and ATOM records:

>d1qnbb2 d.129.1.1 (B:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

Timeline for d1qnbb2:

• d1qnbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qnbb2 appears in SCOPe 2.04
  
• d1qnbb2 appears in SCOPe 2.06
  
• d1qnbb2 appears in the current release, SCOPe 2.08