![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein automated matches [226880] (5 species) not a true protein |
![]() | Species Sulfolobus solfataricus [419801] (1 PDB entry) |
![]() | Domain d1sssb4: 1sss B:93-208 [412687] Other proteins in same PDB: d1sssa3, d1sssb3 automated match to d1wb8a2 complexed with fe |
PDB Entry: 1sss (more details), 2.3 Å
SCOPe Domain Sequences for d1sssb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sssb4 d.44.1.1 (B:93-208) automated matches {Sulfolobus solfataricus} psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl
Timeline for d1sssb4: