Lineage for d1sssb4 (1sss B:93-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946275Protein automated matches [226880] (5 species)
    not a true protein
  7. 2946296Species Sulfolobus solfataricus [419801] (1 PDB entry)
  8. 2946298Domain d1sssb4: 1sss B:93-208 [412687]
    Other proteins in same PDB: d1sssa3, d1sssb3
    automated match to d1wb8a2
    complexed with fe

Details for d1sssb4

PDB Entry: 1sss (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.
PDB Compounds: (B:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1sssb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sssb4 d.44.1.1 (B:93-208) automated matches {Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

SCOPe Domain Coordinates for d1sssb4:

Click to download the PDB-style file with coordinates for d1sssb4.
(The format of our PDB-style files is described here.)

Timeline for d1sssb4:

  • d1sssb4 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1sssb3