Lineage for d1sssb3 (1sss B:4-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690322Protein automated matches [227044] (4 species)
    not a true protein
  7. 2690336Species Sulfolobus solfataricus [419800] (1 PDB entry)
  8. 2690338Domain d1sssb3: 1sss B:4-92 [412686]
    Other proteins in same PDB: d1sssa4, d1sssb4
    automated match to d1wb8a1
    complexed with fe

Details for d1sssb3

PDB Entry: 1sss (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.
PDB Compounds: (B:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1sssb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sssb3 a.2.11.1 (B:4-92) automated matches {Sulfolobus solfataricus}
iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

SCOPe Domain Coordinates for d1sssb3:

Click to download the PDB-style file with coordinates for d1sssb3.
(The format of our PDB-style files is described here.)

Timeline for d1sssb3:

  • d1sssb3 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1sssb4