SCOPe 2.08: Domain d1sssa4: 1sss A:93-208

Lineage for d1sssa4 (1sss A:93-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein automated matches [226880] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [419801] (1 PDB entry)

8. Domain d1sssa4: 1sss A:93-208 [412685]
   Other proteins in same PDB: d1sssa3, d1sssb3
   automated match to d1wb8a2
   complexed with fe

Details for d1sssa4

PDB Entry: 1sss, 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.

PDB Compounds: (A:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1sssa4:

Sequence; same for both SEQRES and ATOM records:

>d1sssa4 d.44.1.1 (A:93-208) automated matches {Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

Timeline for d1sssa4:

• d1sssa4 is new in SCOPe 2.08-stable