SCOPe 2.08: Domain d1sssa3: 1sss A:4-92

Lineage for d1sssa3 (1sss A:4-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein automated matches [227044] (4 species)
   not a true protein

7. Species Sulfolobus solfataricus [419800] (1 PDB entry)

8. Domain d1sssa3: 1sss A:4-92 [412684]
   Other proteins in same PDB: d1sssa4, d1sssb4
   automated match to d1wb8a1
   complexed with fe

Details for d1sssa3

PDB Entry: 1sss, 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.

PDB Compounds: (A:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1sssa3:

Sequence; same for both SEQRES and ATOM records:

>d1sssa3 a.2.11.1 (A:4-92) automated matches {Sulfolobus solfataricus}
iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

Timeline for d1sssa3:

• d1sssa3 is new in SCOPe 2.08-stable