Lineage for d1eqsa_ (1eqs A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013399Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 3013400Species Streptomyces sp., K15 [TaxId:1931] [56604] (8 PDB entries)
  8. 3013403Domain d1eqsa_: 1eqs A: [412673]
    automated match to d1j9ma_
    mutant

Details for d1eqsa_

PDB Entry: 1eqs (more details), 1.65 Å

PDB Description: k38h mutant of streptomyces k15 dd-transpeptidase
PDB Compounds: (A:) dd-transpeptidase

SCOPe Domain Sequences for d1eqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqsa_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]}
vtkptiaavggyamnngtgttlytkaadtrrstgstthimtakvvlaqsnlnldakvtiq
kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
astsiparesdatkimnygfal

SCOPe Domain Coordinates for d1eqsa_:

Click to download the PDB-style file with coordinates for d1eqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1eqsa_:

  • d1eqsa_ is new in SCOPe 2.08-stable