SCOP 1.59: Domain d1qnba2: 1qnb A:116-198

Lineage for d1qnba2 (1qnb A:116-198)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1qnba2: 1qnb A:116-198 [41267]

Details for d1qnba2

PDB Entry: 1qnb, 2.23 Å

PDB Description: crystal structure of the t(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.

SCOP Domain Sequences for d1qnba2:

Sequence; same for both SEQRES and ATOM records:

>d1qnba2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

Timeline for d1qnba2:

• d1qnba2 first appeared (with stable ids) in SCOP 1.55
  
• d1qnba2 appears in SCOP 1.57
  
• d1qnba2 appears in SCOP 1.61
  
• d1qnba2 appears in the current release, SCOPe 2.08