SCOPe 2.08: Domain d1bera3: 1ber A:9-137

Lineage for d1bera3 (1ber A:9-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (32 PDB entries)

8. Domain d1bera3: 1ber A:9-137 [412667]
   Other proteins in same PDB: d1bera4, d1berb4
   automated match to d1i5zb2
   protein/DNA complex

Details for d1bera3

PDB Entry: 1ber, 2.5 Å

PDB Description: structure of the cap-dna complex at 2.5 angstroms resolution: a complete picture of the protein-dna interface

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1bera3:

Sequence; same for both SEQRES and ATOM records:

>d1bera3 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

Timeline for d1bera3:

• d1bera3 is new in SCOPe 2.08-stable