Lineage for d1b7ca_ (1b7c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690984Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2690995Species Bacillus pasteurii [TaxId:1474] [46629] (6 PDB entries)
  8. 2690996Domain d1b7ca_: 1b7c A: [412666]
    automated match to d1b7va_
    complexed with hem

Details for d1b7ca_

PDB Entry: 1b7c (more details), 0.97 Å

PDB Description: 0.97 a crystal structure of cytochrome c-553 from bacillus pasteurii
PDB Compounds: (A:) cytochrome c-553

SCOPe Domain Sequences for d1b7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ca_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

SCOPe Domain Coordinates for d1b7ca_:

Click to download the PDB-style file with coordinates for d1b7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ca_:

  • d1b7ca_ is new in SCOPe 2.08-stable