SCOPe 2.08: Domain d7nx8h_: 7nx8 H:

Lineage for d7nx8h_ (7nx8 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d7nx8h_: 7nx8 H: [412651]
   Other proteins in same PDB: d7nx8b2, d7nx8e_, d7nx8l1, d7nx8l2
   automated match to d6shgh_
   complexed with cit, cl, gol, nag, peg, so4; mutant

Details for d7nx8h_

PDB Entry: 7nx8, 1.95 Å

PDB Description: crystal structure of the k417t mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs

PDB Compounds: (H:) EY6A Fab heavy chain

SCOPe Domain Sequences for d7nx8h_:

Sequence, based on SEQRES records:

>d7nx8h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasaftfssydmhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakdggklwvyyfdywgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records):

>d7nx8h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasaftfssydmhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakdggklwvyyfdywgqgtlvtvs
sastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Timeline for d7nx8h_:

• d7nx8h_ is new in SCOPe 2.08-stable