Lineage for d7nx8a_ (7nx8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742369Domain d7nx8a_: 7nx8 A: [412650]
    Other proteins in same PDB: d7nx8b2, d7nx8e_, d7nx8l1, d7nx8l2
    automated match to d6shgh_
    complexed with cit, cl, gol, nag, peg, so4; mutant

Details for d7nx8a_

PDB Entry: 7nx8 (more details), 1.95 Å

PDB Description: crystal structure of the k417t mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs
PDB Compounds: (A:) COVOX-222 Fab heavy chain

SCOPe Domain Sequences for d7nx8a_:

Sequence, based on SEQRES records: (download)

>d7nx8a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgltvssnymswvrqapgkglewvsviysggstfya
dsvkgrftisrdnskntlylqmnslgaedtavyycargegspgnwfdpwgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d7nx8a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgltvssnymswvrqapgkglewvsviysggstfya
dsvkgrftisrdnskntlylqmnslgaedtavyycargegspgnwfdpwgqgtlvtvssa
stkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d7nx8a_:

Click to download the PDB-style file with coordinates for d7nx8a_.
(The format of our PDB-style files is described here.)

Timeline for d7nx8a_:

  • d7nx8a_ is new in SCOPe 2.08-stable