Lineage for d7nx7a_ (7nx7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742595Domain d7nx7a_: 7nx7 A: [412648]
    Other proteins in same PDB: d7nx7b2, d7nx7e_, d7nx7l1, d7nx7l2
    automated match to d6shgh_
    complexed with cit, cl, gol, nag, so4; mutant

Details for d7nx7a_

PDB Entry: 7nx7 (more details), 2.3 Å

PDB Description: crystal structure of the k417n mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs
PDB Compounds: (A:) COVOX-222 Fab heavy chain

SCOPe Domain Sequences for d7nx7a_:

Sequence, based on SEQRES records: (download)

>d7nx7a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgltvssnymswvrqapgkglewvsviysggstfya
dsvkgrftisrdnskntlylqmnslgaedtavyycargegspgnwfdpwgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d7nx7a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgltvssnymswvrqapgkglewvsviysggstfya
dsvkgrftisrdnskntlylqmnslgaedtavyycargegspgnwfdpwgqgtlvtvssa
stkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d7nx7a_:

Click to download the PDB-style file with coordinates for d7nx7a_.
(The format of our PDB-style files is described here.)

Timeline for d7nx7a_:

  • d7nx7a_ is new in SCOPe 2.08-stable