Lineage for d1qn8a1 (1qn8 A:16-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1668834Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1668835Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1668836Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1668895Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)
  8. 1668924Domain d1qn8a1: 1qn8 A:16-115 [41258]

Details for d1qn8a1

PDB Entry: 1qn8 (more details), 2.1 Å

PDB Description: crystal structure of the t(-28) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
PDB Compounds: (A:) transcription initiation factor tfiid-1

SCOPe Domain Sequences for d1qn8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qn8a1 d.129.1.1 (A:16-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
khpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifa
sgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

SCOPe Domain Coordinates for d1qn8a1:

Click to download the PDB-style file with coordinates for d1qn8a1.
(The format of our PDB-style files is described here.)

Timeline for d1qn8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qn8a2