SCOP 1.69: Domain d1qn8a1: 1qn8 A:16-115

Lineage for d1qn8a1 (1qn8 A:16-115)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.129: TBP-like [55944] (8 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1qn8a1: 1qn8 A:16-115 [41258]

Details for d1qn8a1

PDB Entry: 1qn8, 2.1 Å

PDB Description: crystal structure of the t(-28) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.

SCOP Domain Sequences for d1qn8a1:

Sequence; same for both SEQRES and ATOM records:

>d1qn8a1 d.129.1.1 (A:16-115) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
khpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifa
sgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

Timeline for d1qn8a1:

• d1qn8a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qn8a1 appears in SCOP 1.67
  
• d1qn8a1 appears in SCOP 1.71
  
• d1qn8a1 appears in the current release, SCOPe 2.08