Lineage for d7kq7h_ (7kq7 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745381Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)
  8. 2745388Domain d7kq7h_: 7kq7 H: [412565]
    Other proteins in same PDB: d7kq7l1, d7kq7l2
    automated match to d6shgh_

Details for d7kq7h_

PDB Entry: 7kq7 (more details), 2.2 Å

PDB Description: crystal structure of il21r in complex with an antibody fab fragment
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d7kq7h_:

Sequence, based on SEQRES records: (download)

>d7kq7h_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesggglvqpgrslrlscaasgvtfsdyhmawvrqapkkglewvatiiydaartyy
rdsvkgrftisrdnaknslylqmnslraedtavyycatwqttgtpgwfaywgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Sequence, based on observed residues (ATOM records): (download)

>d7kq7h_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesggglvqpgrslrlscaasgvtfsdyhmawvrqapkkglewvatiiydaartyy
rdsvkgrftisrdnaknslylqmnslraedtavyycatwqttgtpgwfaywgqgtlvtvs
sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkve

SCOPe Domain Coordinates for d7kq7h_:

Click to download the PDB-style file with coordinates for d7kq7h_.
(The format of our PDB-style files is described here.)

Timeline for d7kq7h_:

  • d7kq7h_ is new in SCOPe 2.08-stable