Lineage for d7kfwh_ (7kfw H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743131Domain d7kfwh_: 7kfw H: [412536]
    Other proteins in same PDB: d7kfwa_, d7kfwb_, d7kfwd1, d7kfwd2, d7kfwe_, d7kfwg1, d7kfwg2, d7kfwl1, d7kfwl2
    automated match to d6shgh_
    complexed with nag

Details for d7kfwh_

PDB Entry: 7kfw (more details), 2.79 Å

PDB Description: structural basis for a germline-biased antibody response to sars-cov-2 (rbd:c1a-b3 fab)
PDB Compounds: (H:) heavy chain of antibody C1A-B3 Fab

SCOPe Domain Sequences for d7kfwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kfwh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggliqpggslrlscaasgftvssnymswvrqapgkglewvsviysggttyya
dsvkgrftisrdnskntvflqmnslraedtavyycargdvsgyrygldywgqgtlvtvsg
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

SCOPe Domain Coordinates for d7kfwh_:

Click to download the PDB-style file with coordinates for d7kfwh_.
(The format of our PDB-style files is described here.)

Timeline for d7kfwh_:

  • d7kfwh_ is new in SCOPe 2.08-stable