Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus hu/gii.4/sydney/nsw0514/2012/au [TaxId:1241973] [419916] (10 PDB entries) |
Domain d7jiea_: 7jie A: [412487] Other proteins in same PDB: d7jiec_, d7jied1, d7jied2, d7jiee_, d7jief1, d7jief2 automated match to d5or7a_ |
PDB Entry: 7jie (more details), 2.25 Å
SCOPe Domain Sequences for d7jiea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jiea_ b.121.4.0 (A:) automated matches {Norovirus hu/gii.4/sydney/nsw0514/2012/au [TaxId: 1241973]} kpfsvpvltveemtnsrfpipleklftgpssafvvqpqngrcttdgvllgttqlspvnic tfrgdvthitgsrnytmnlasqnwndydpteeipaplgtpdfvgkiqgvltqttrtdgst rghkatvytgsadfapklgrvqfetdtdrdfeanqntkftpvgviqdggtthrnepqqwv lpsysgrnthnvhlapavaptfpgeqllffrstmpgcsgypnmdldcllpqewvqyfyqe aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf ytlapmg
Timeline for d7jiea_: