SCOPe 2.08: Domain d7jiba1: 7jib A:1-298

Lineage for d7jiba1 (7jib A:1-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)

6. Protein automated matches [190302] (11 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [420071] (20 PDB entries)

8. Domain d7jiba1: 7jib A:1-298 [412485]
   Other proteins in same PDB: d7jiba2, d7jibb_
   automated match to d2xyqa_
   complexed with cl, gta, mgp, sah, sam, v9g, zn

Details for d7jiba1

PDB Entry: 7jib, 2.65 Å

PDB Description: room temperature crystal structure of nsp10/nsp16 from sars-cov-2 with substrates and products of 2'-o-methylation of the cap-1

PDB Compounds: (A:) 2'-O-methyltransferase

SCOPe Domain Sequences for d7jiba1:

Sequence; same for both SEQRES and ATOM records:

>d7jiba1 c.66.1.25 (A:1-298) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
ssqawqpgvampnlykmqrmllekcdlqnygdsatlpkgimmnvakytqlcqylntltla
vpynmrvihfgagsdkgvapgtavlrqwlptgtllvdsdlndfvsdadstligdcatvht
ankwdliisdmydpktknvtkendskegfftyicgfiqqklalggsvaikitehswnadl
yklmghfawwtafvtnvnassseafligcnylgkpreqidgyvmhanyifwrntnpiqls
syslfdmskfplklrgtavmslkegqindmilsllskgrliirennrvvissdvlvnn

Timeline for d7jiba1:

• d7jiba1 is new in SCOPe 2.08-stable