![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries) |
![]() | Domain d1qnea1: 1qne A:12-115 [41246] |
PDB Entry: 1qne (more details), 1.9 Å
SCOPe Domain Sequences for d1qnea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnea1 d.129.1.1 (A:12-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki
Timeline for d1qnea1: