SCOPe 2.03: Domain d1vokb2: 1vok B:116-199

Lineage for d1vokb2 (1vok B:116-199)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1vokb2: 1vok B:116-199 [41245]
   complexed with so4

Details for d1vokb2

PDB Entry: 1vok, 2.1 Å

PDB Description: arabidopsis thaliana tbp (dimer)

PDB Compounds: (B:) tata-box-binding protein

SCOPe Domain Sequences for d1vokb2:

Sequence; same for both SEQRES and ATOM records:

>d1vokb2 d.129.1.1 (B:116-199) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrkiq

Timeline for d1vokb2:

• d1vokb2 first appeared (with stable ids) in SCOP 1.55
  
• d1vokb2 appears in SCOPe 2.02
  
• d1vokb2 appears in SCOPe 2.04
  
• d1vokb2 appears in the current release, SCOPe 2.08