Lineage for d7dkzl_ (7dkz L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027972Domain d7dkzl_: 7dkz L: [412433]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_
    automated match to d6k61l_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzl_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (L:) PsaL

SCOPe Domain Sequences for d7dkzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkzl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
vvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgpfv
kagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqpdq
lqtadgwakftggfffggisgviwaffllyv

SCOPe Domain Coordinates for d7dkzl_:

Click to download the PDB-style file with coordinates for d7dkzl_.
(The format of our PDB-style files is described here.)

Timeline for d7dkzl_:

  • d7dkzl_ is new in SCOPe 2.08-stable