Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
Protein automated matches [375526] (6 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
Domain d7dkzl_: 7dkz L: [412433] Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_ automated match to d6k61l_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 7dkz (more details), 2.39 Å
SCOPe Domain Sequences for d7dkzl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dkzl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} vvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgpfv kagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqpdq lqtadgwakftggfffggisgviwaffllyv
Timeline for d7dkzl_: