Lineage for d1voka1 (1vok A:7-115)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35722Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 35723Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 35724Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)
  8. 35745Domain d1voka1: 1vok A:7-115 [41242]

Details for d1voka1

PDB Entry: 1vok (more details), 2.1 Å

PDB Description: arabidopsis thaliana tbp (dimer)

SCOP Domain Sequences for d1voka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voka1 d.129.1.1 (A:7-115) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
egsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrire
pkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

SCOP Domain Coordinates for d1voka1:

Click to download the PDB-style file with coordinates for d1voka1.
(The format of our PDB-style files is described here.)

Timeline for d1voka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1voka2