Lineage for d7chfa_ (7chf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743059Domain d7chfa_: 7chf A: [412412]
    Other proteins in same PDB: d7chfb1, d7chfb2, d7chfl1, d7chfl2, d7chfr_
    automated match to d6shgh_

Details for d7chfa_

PDB Entry: 7chf (more details), 2.67 Å

PDB Description: crystal structure of the sars-cov-2 rbd in complex with bd-604 fab and bd-368-2 fab
PDB Compounds: (A:) BD-368-2 Fab heavy chain

SCOPe Domain Sequences for d7chfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7chfa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesgggvvqpggslrlscaasgfafttyamnwvrqapgrglewvsaisdgggsayya
dsvkgrftisrdnskntlylqmnslraedtavyycaktrgrglydyvwgskdywgqgtlv
tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d7chfa_:

Click to download the PDB-style file with coordinates for d7chfa_.
(The format of our PDB-style files is described here.)

Timeline for d7chfa_:

  • d7chfa_ is new in SCOPe 2.08-stable