Lineage for d7bekh_ (7bek H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742434Domain d7bekh_: 7bek H: [412337]
    Other proteins in same PDB: d7beke_, d7bekl1, d7bekl2
    automated match to d6shgh_
    complexed with cl, gol, peg, so4, trs

Details for d7bekh_

PDB Entry: 7bek (more details), 2.04 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in complex with covox-158 fab (crystal form 2)
PDB Compounds: (H:) COVOX-158 heavy chain

SCOPe Domain Sequences for d7bekh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bekh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggdliqpggslrlscaasgvtvssnymswvrqapgkglewvsiiypggstfya
dsvkgrftisrdnskntlylqmhslraedtavyycardlgsgdmdvwgkgttvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d7bekh_:

Click to download the PDB-style file with coordinates for d7bekh_.
(The format of our PDB-style files is described here.)

Timeline for d7bekh_:

  • d7bekh_ is new in SCOPe 2.08-stable