Lineage for d7ak5w_ (7ak5 W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029490Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily)
    three-helix bundle, with long extended loops that interact with other subunits
  4. 3029491Superfamily f.71.1: LYR protein-like [418775] (2 families) (S)
  5. 3029492Family f.71.1.1: LYR proteins [418863] (4 proteins)
  6. 3029513Protein automated matches [419269] (4 species)
    not a true protein
  7. 3029514Species Mouse (Mus musculus) [TaxId:10090] [420091] (4 PDB entries)
  8. 3029518Domain d7ak5w_: 7ak5 W: [412332]
    Other proteins in same PDB: d7ak5f1, d7ak5f2, d7ak5f3, d7ak5t_, d7ak5u_
    automated match to d5lc5w_
    complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, zn

Details for d7ak5w_

PDB Entry: 7ak5 (more details), 3.17 Å

PDB Description: cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a
PDB Compounds: (W:) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

SCOPe Domain Sequences for d7ak5w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ak5w_ f.71.1.1 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tsvkpifsrdlneakrrvrelyrawyrevpntvhlmqlditvkqgrdkvremfmknahvt
dprvvdllvikgkmelqetikvwkqrthvmrffhetetprpkdflskfymghdp

SCOPe Domain Coordinates for d7ak5w_:

Click to download the PDB-style file with coordinates for d7ak5w_.
(The format of our PDB-style files is described here.)

Timeline for d7ak5w_:

  • d7ak5w_ is new in SCOPe 2.08-stable