Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily) three-helix bundle, with long extended loops that interact with other subunits |
Superfamily f.71.1: LYR protein-like [418775] (2 families) |
Family f.71.1.1: LYR proteins [418863] (4 proteins) |
Protein automated matches [419269] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [420091] (4 PDB entries) |
Domain d7ak5w_: 7ak5 W: [412332] Other proteins in same PDB: d7ak5f1, d7ak5f2, d7ak5f3, d7ak5t_, d7ak5u_ automated match to d5lc5w_ complexed with 3pe, atp, cdl, ehz, fes, fmn, ndp, pc1, sf4, zn |
PDB Entry: 7ak5 (more details), 3.17 Å
SCOPe Domain Sequences for d7ak5w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ak5w_ f.71.1.1 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tsvkpifsrdlneakrrvrelyrawyrevpntvhlmqlditvkqgrdkvremfmknahvt dprvvdllvikgkmelqetikvwkqrthvmrffhetetprpkdflskfymghdp
Timeline for d7ak5w_: