![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
![]() | Protein automated matches [375526] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
![]() | Domain d6zool_: 6zoo L: [412327] Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zoop_ automated match to d6k61l_ complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6zoo (more details), 2.74 Å
SCOPe Domain Sequences for d6zool_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zool_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp dqlqtadgwakftggfffggisgvtwaffllyvldlpyf
Timeline for d6zool_: