Lineage for d6zool_ (6zoo L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027974Domain d6zool_: 6zoo L: [412327]
    Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zoop_
    automated match to d6k61l_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zool_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (L:) PsaL domain-containing protein

SCOPe Domain Sequences for d6zool_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zool_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp
fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp
dqlqtadgwakftggfffggisgvtwaffllyvldlpyf

SCOPe Domain Coordinates for d6zool_:

Click to download the PDB-style file with coordinates for d6zool_.
(The format of our PDB-style files is described here.)

Timeline for d6zool_:

  • d6zool_ is new in SCOPe 2.08-stable