Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster |
Family d.15.13.0: automated matches [254297] (1 protein) not a true family |
Protein automated matches [254683] (5 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [420085] (15 PDB entries) |
Domain d6zkv12: 6zkv 1:254-339 [412324] Other proteins in same PDB: d6zkv11, d6zkv13, d6zkv4_, d6zkvg_, d6zkvj_, d6zkvx_ automated match to d7b93f2 complexed with 3pe, amp, cdl, fes, fmn, k, myr, ndp, pc1, sf4, zmp, zn |
PDB Entry: 6zkv (more details), 2.9 Å
SCOPe Domain Sequences for d6zkv12:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkv12 d.15.13.0 (1:254-339) automated matches {Sheep (Ovis aries) [TaxId: 9940]} klfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipggsstplipksvce tvlmdfdaliqaqtglgtaavivmdr
Timeline for d6zkv12:
View in 3D Domains from other chains: (mouse over for more information) d6zkv4_, d6zkvg_, d6zkvj_, d6zkvx_ |