Lineage for d6zkn13 (6zkn 1:340-438)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708905Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 2708913Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 2708914Protein automated matches [254684] (5 species)
    not a true protein
  7. 2708920Species Sheep (Ovis aries) [TaxId:9940] [420086] (15 PDB entries)
  8. 2708928Domain d6zkn13: 6zkn 1:340-438 [412309]
    Other proteins in same PDB: d6zkn11, d6zkn12, d6zkng_, d6zknj_, d6zknx_
    automated match to d6ztqf3
    complexed with 3pe, 970, amp, cdl, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zkn13

PDB Entry: 6zkn (more details), 2.9 Å

PDB Description: complex i inhibited by rotenone, open3
PDB Compounds: (1:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d6zkn13:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zkn13 a.29.12.0 (1:340-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
stdivkaiarliefykhescgqctpcregvdwmnkvmarfvrgdarpaeidslweiskqi
eghticalgdgaawpvqglirhfrpeleermqrfaqqhq

SCOPe Domain Coordinates for d6zkn13:

Click to download the PDB-style file with coordinates for d6zkn13.
(The format of our PDB-style files is described here.)

Timeline for d6zkn13:

  • d6zkn13 is new in SCOPe 2.08-stable