Lineage for d6zki12 (6zki 1:254-339)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935190Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 2935198Family d.15.13.0: automated matches [254297] (1 protein)
    not a true family
  6. 2935199Protein automated matches [254683] (5 species)
    not a true protein
  7. 2935205Species Sheep (Ovis aries) [TaxId:9940] [420085] (15 PDB entries)
  8. 2935211Domain d6zki12: 6zki 1:254-339 [412292]
    Other proteins in same PDB: d6zki11, d6zki13, d6zkig_, d6zkij_, d6zkix_
    automated match to d7b93f2
    complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zki12

PDB Entry: 6zki (more details), 2.8 Å

PDB Description: complex i with nadh, open2
PDB Compounds: (1:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d6zki12:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zki12 d.15.13.0 (1:254-339) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
klfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipggsstplipksvce
tvlmdfdaliqaqtglgtaavivmdr

SCOPe Domain Coordinates for d6zki12:

Click to download the PDB-style file with coordinates for d6zki12.
(The format of our PDB-style files is described here.)

Timeline for d6zki12:

  • d6zki12 is new in SCOPe 2.08-stable