Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily) three-helix bundle, with long extended loops that interact with other subunits |
Superfamily f.71.1: LYR protein-like [418775] (2 families) |
Family f.71.1.1: LYR proteins [418863] (4 proteins) |
Protein automated matches [419269] (4 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [420083] (15 PDB entries) |
Domain d6zkhg_: 6zkh g: [412290] Other proteins in same PDB: d6zkh11, d6zkh12, d6zkh13, d6zkhj_, d6zkhx_ automated match to d5lc5w_ complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn |
PDB Entry: 6zkh (more details), 3 Å
SCOPe Domain Sequences for d6zkhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkhg_ f.71.1.1 (g:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} tsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfkknahvt dprvvdllvikgkmeleetinvwkqrthvmrffheteaprpkdflskfyvghdp
Timeline for d6zkhg_: