Lineage for d6zkhg_ (6zkh g:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029490Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily)
    three-helix bundle, with long extended loops that interact with other subunits
  4. 3029491Superfamily f.71.1: LYR protein-like [418775] (2 families) (S)
  5. 3029492Family f.71.1.1: LYR proteins [418863] (4 proteins)
  6. 3029513Protein automated matches [419269] (4 species)
    not a true protein
  7. 3029519Species Sheep (Ovis aries) [TaxId:9940] [420083] (15 PDB entries)
  8. 3029530Domain d6zkhg_: 6zkh g: [412290]
    Other proteins in same PDB: d6zkh11, d6zkh12, d6zkh13, d6zkhj_, d6zkhx_
    automated match to d5lc5w_
    complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zkhg_

PDB Entry: 6zkh (more details), 3 Å

PDB Description: complex i with nadh, open1
PDB Compounds: (g:) NADH:ubiquinone oxidoreductase subunit A6

SCOPe Domain Sequences for d6zkhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zkhg_ f.71.1.1 (g:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
tsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfkknahvt
dprvvdllvikgkmeleetinvwkqrthvmrffheteaprpkdflskfyvghdp

SCOPe Domain Coordinates for d6zkhg_:

Click to download the PDB-style file with coordinates for d6zkhg_.
(The format of our PDB-style files is described here.)

Timeline for d6zkhg_:

  • d6zkhg_ is new in SCOPe 2.08-stable