Lineage for d6zkf11 (6zkf 1:9-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923529Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2923530Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) (S)
  5. 2923551Family c.142.1.0: automated matches [394200] (1 protein)
    not a true family
  6. 2923552Protein automated matches [394201] (3 species)
    not a true protein
  7. 2923558Species Sheep (Ovis aries) [TaxId:9940] [420084] (15 PDB entries)
  8. 2923562Domain d6zkf11: 6zkf 1:9-253 [412283]
    Other proteins in same PDB: d6zkf12, d6zkf13, d6zkfg_, d6zkfj_, d6zkfx_
    automated match to d7b93f1
    complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zkf11

PDB Entry: 6zkf (more details), 2.8 Å

PDB Description: complex i during turnover, open3
PDB Compounds: (1:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d6zkf11:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zkf11 c.142.1.0 (1:9-253) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
ktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgr
ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggra
mgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicge
etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgre
rnsgt

SCOPe Domain Coordinates for d6zkf11:

Click to download the PDB-style file with coordinates for d6zkf11.
(The format of our PDB-style files is described here.)

Timeline for d6zkf11:

  • d6zkf11 is new in SCOPe 2.08-stable