Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) |
Family c.142.1.0: automated matches [394200] (1 protein) not a true family |
Protein automated matches [394201] (3 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [420084] (15 PDB entries) |
Domain d6zkf11: 6zkf 1:9-253 [412283] Other proteins in same PDB: d6zkf12, d6zkf13, d6zkfg_, d6zkfj_, d6zkfx_ automated match to d7b93f1 complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn |
PDB Entry: 6zkf (more details), 2.8 Å
SCOPe Domain Sequences for d6zkf11:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkf11 c.142.1.0 (1:9-253) automated matches {Sheep (Ovis aries) [TaxId: 9940]} ktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgr ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggra mgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicge etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgre rnsgt
Timeline for d6zkf11: