Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.129: TBP-like [55944] (4 superfamilies) |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries) |
Domain d1c9br1: 1c9b R:158-252 [41224] Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2 |
PDB Entry: 1c9b (more details), 2.65 Å
SCOP Domain Sequences for d1c9br1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9br1 d.129.1.1 (R:158-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)} gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg kmvctgakseeqsrlaarkyarvvqklgfpakfld
Timeline for d1c9br1: