Lineage for d6yezl_ (6yez L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027975Domain d6yezl_: 6yez L: [412227]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_
    automated match to d6k61l_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezl_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (L:) PsaL

SCOPe Domain Sequences for d6yezl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp
fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp
dqlqtadgwakftggfffggisgvtwaffllyvldlpyf

SCOPe Domain Coordinates for d6yezl_:

Click to download the PDB-style file with coordinates for d6yezl_.
(The format of our PDB-style files is described here.)

Timeline for d6yezl_:

  • d6yezl_ is new in SCOPe 2.08-stable