Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.0: automated matches [227159] (1 protein) not a true family |
Protein automated matches [226866] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225002] (11 PDB entries) |
Domain d6y2cb1: 6y2c B:261-350 [412211] Other proteins in same PDB: d6y2cb2 automated match to d6y2ca_ complexed with edo, zn |
PDB Entry: 6y2c (more details), 2 Å
SCOPe Domain Sequences for d6y2cb1:
Sequence, based on SEQRES records: (download)
>d6y2cb1 d.51.1.0 (B:261-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} frevrneygsriggnegidvpiprfavgivigrngemikkiqndagvriqfkpddgttpe riaqitgppdrcqhaaeiitdllrsvqagn
>d6y2cb1 d.51.1.0 (B:261-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} frevrneegidvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgp pdrcqhaaeiitdllrsvqagn
Timeline for d6y2cb1: