SCOPe 2.08: Domain d6y2cb1: 6y2c B:261-350

Lineage for d6y2cb1 (6y2c B:261-350)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.0: automated matches [227159] (1 protein)
   not a true family

6. Protein automated matches [226866] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225002] (11 PDB entries)

8. Domain d6y2cb1: 6y2c B:261-350 [412211]
   Other proteins in same PDB: d6y2cb2
   automated match to d6y2ca_
   complexed with edo, zn

Details for d6y2cb1

PDB Entry: 6y2c, 2 Å

PDB Description: crystal structure of the third kh domain of fubp1

PDB Compounds: (B:) Far upstream element-binding protein 1

SCOPe Domain Sequences for d6y2cb1:

Sequence, based on SEQRES records:

>d6y2cb1 d.51.1.0 (B:261-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frevrneygsriggnegidvpiprfavgivigrngemikkiqndagvriqfkpddgttpe
riaqitgppdrcqhaaeiitdllrsvqagn

Sequence, based on observed residues (ATOM records):

>d6y2cb1 d.51.1.0 (B:261-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frevrneegidvpiprfavgivigrngemikkiqndagvriqfkpddgttperiaqitgp
pdrcqhaaeiitdllrsvqagn

Timeline for d6y2cb1:

• d6y2cb1 is new in SCOPe 2.08-stable