Lineage for d1c9bf2 (1c9b F:253-337)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) 
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries) 
Domain d1c9bf2: 1c9b F:253-337 [41219]
Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2
Details for d1c9bf2
PDB Entry: 1c9b (more details), 2.65 Å
PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
SCOP Domain Sequences for d1c9bf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9bf2 d.129.1.1 (F:253-337) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrk
SCOP Domain Coordinates for d1c9bf2:
Click to download the PDB-style file with coordinates for d1c9bf2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c9bf2:
View in 3D
