Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries) |
Domain d1c9bf1: 1c9b F:158-252 [41218] Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2 |
PDB Entry: 1c9b (more details), 2.65 Å
SCOP Domain Sequences for d1c9bf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9bf1 d.129.1.1 (F:158-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)} gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg kmvctgakseeqsrlaarkyarvvqklgfpakfld
Timeline for d1c9bf1: