SCOP 1.59: Domain d1c9bb2: 1c9b B:253-337

Lineage for d1c9bb2 (1c9b B:253-337)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries)

8. Domain d1c9bb2: 1c9b B:253-337 [41217]
   Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2

Details for d1c9bb2

PDB Entry: 1c9b, 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)

SCOP Domain Sequences for d1c9bb2:

Sequence; same for both SEQRES and ATOM records:

>d1c9bb2 d.129.1.1 (B:253-337) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
fkiqnmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvl
tgakvraeiyeafeniypilkgfrk

Timeline for d1c9bb2:

• d1c9bb2 first appeared (with stable ids) in SCOP 1.55
  
• d1c9bb2 appears in SCOP 1.57
  
• d1c9bb2 appears in SCOP 1.61
  
• d1c9bb2 appears in the current release, SCOPe 2.08