Lineage for d1c9bb1 (1c9b B:158-252)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83826Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 83827Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 83828Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 83829Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 83903Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries)
  8. 83910Domain d1c9bb1: 1c9b B:158-252 [41216]
    Other proteins in same PDB: d1c9ba1, d1c9ba2, d1c9be1, d1c9be2, d1c9bi1, d1c9bi2, d1c9bm1, d1c9bm2, d1c9bq1, d1c9bq2

Details for d1c9bb1

PDB Entry: 1c9b (more details), 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)

SCOP Domain Sequences for d1c9bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9bb1 d.129.1.1 (B:158-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
kmvctgakseeqsrlaarkyarvvqklgfpakfld

SCOP Domain Coordinates for d1c9bb1:

Click to download the PDB-style file with coordinates for d1c9bb1.
(The format of our PDB-style files is described here.)

Timeline for d1c9bb1: